RUPES S.p.A.
Italiaanse fabrikant van polijst-, schuur- en oppervlakteafwerkingsgereedschappen.
RUPES produceert polijstmachines, schuurmachines, stofafzuigsystemen en pasta's voor autodetailing en industriële afwerking. Het Italiaanse bedrijf, opgericht in 1947, exporteert gereedschappen en verbruiksartikelen via professionele distributeurs over de hele wereld.
- Type
- manufacturer (our classification of the record, not a statement by the company)
- Role
- Manufacturer
- Location
- Vermezzo con Zelo, Italy
- Founded
- 1947
- Website
- rupes.com
- Categories
- Auto-benodigdheden en -verzorging, Gereedschappen en uitrusting voor de automobielindustrie
- Markets
- Italië, Duitsland, Verenigde Staten, Frankrijk
What is established and what is not
No facet of this company has been investigated yet. The facts below are collected records, not an assessment: nothing here confirms manufacturing, ownership or trading status beyond what each record literally says.
Verified facts
- domain-registered (green), checked 2026-08-09 Domain registry record
- lei-active (green), checked 2026-08-09 GLEIF
- corporate-mail-on-domain (green), checked 2026-08-09 Mail server of the company domain
- places-goods-on-market (green), checked 2026-08-30 Registre national des producteurs (ADEME/SYDEREP), France
- sanctions-clear (green), checked 2026-08-09 OpenSanctions
- debarment-clear (green), checked 2026-08-09 OpenSanctions
- export-registered (green), checked 2026-08-09 EU EORI validation (European Commission)
- state-aid-sector (green), effective since 2026-02-23 Registro Nazionale degli Aiuti di Stato (rna.gov.it), open data
- vat-valid (green), checked 2026-08-09 VIES
Import rules for these goods
- Consumer goods sold in the EU fall under the General Product Safety Regulation (GPSR, applies since 13 Dec 2024): a responsible person in the EU is mandatory. EUR-Lex: Regulation (EU) 2023/988 (GPSR)